LL-37 5 mg – Human Antimicrobial Peptide for Immunological and Cellular Research

LL-37 is a human-derived antimicrobial peptide belonging to the cathelicidin family. It is the only known human cathelicidin capable of broad-spectrum activity and is widely used in laboratory environments to study innate immunity, cellular defense mechanisms, wound-healing pathways, and microbial interaction models. LL-37 is of particular interest in research focused on epithelial barrier function, immunomodulation, and host–pathogen dynamics.

Each vial contains 5 mg of high-purity LL-37 produced under GMP-compliant laboratory conditions and sealed in tamper-evident packaging to ensure analytical integrity. Researchers in Colombia rely on Poly Biotech for consistent access to advanced antimicrobial peptides for controlled studies in immunology and cellular biology.

Key Features

• 5 mg pharmaceutical-grade LL-37 peptide per vial
• Lyophilized powder for enhanced stability
• Tamper-evident vial with precise research labeling
• Free, discreet nationwide shipping within Colombia

Applications in Research

LL-37 is commonly used in laboratory studies involving:

• Innate immune response and antimicrobial defense pathways
• Cellular models of wound interaction and tissue regeneration
• Host–pathogen interaction studies with bacteria, fungi, and viruses
• Inflammation, cytokine regulation, and epithelial barrier function
• Comparative research with human defensins and other cathelicidins

Technical Information

• Compound: LL-37 (human cathelicidin peptide)
• Sequence: [LL-37, 37 aa]
• Form: Lyophilized powder
• Content: 5 mg per vial
• Purity: ≥ 98% (HPLC-verified)
• Appearance: White to off-white powder
• Storage: Store at 2–8 °C; protect from moisture and light
• Use: Intended exclusively for laboratory research

References

• PubChem – LL-37
• NCBI – LL-37 in host defense and inflammation
• Wikipedia – Cathelicidin Family